(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0276

BA000037.VV0276      Location/Qualifiers
FT   CDS             complement(287229..287606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0276"
FT                   /product="hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93040"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93040"
FT                   /db_xref="GOA:Q7MPT6"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPT6"
FT                   /protein_id="BAC93040.1"
FT                   /translation="MSPLHNTTQEGANMQFMMRLAPITFPIAMLAGLGWCIGIALLEQP
FT                   HGIGYALTRHCLMVFVVLAPWLMLKLMFYVIVSLGRKLGLIPPARPTHSLGYEESLYWF
FT                   SVLAFFDGKRSRMPKRPIRRN"
     MSPLHNTTQE GANMQFMMRL APITFPIAML AGLGWCIGIA LLEQPHGIGY ALTRHCLMVF        60
     VVLAPWLMLK LMFYVIVSLG RKLGLIPPAR PTHSLGYEES LYWFSVLAFF DGKRSRMPKR       120
     PIRRN                                                                   125
//

If you have problems or comments...

PBIL Back to PBIL home page