(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0287

BA000037.VV0287      Location/Qualifiers
FT   CDS             298014..298184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0287"
FT                   /product="ribosomal protein L33"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93051"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93051"
FT                   /db_xref="GOA:Q7MPS5"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018264"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MPS5"
FT                   /protein_id="BAC93051.1"
FT                   /translation="MAKKGIREKIRLVSTANTGHFYTTDKNKRNMPGKFEIKKFDPVVR
FT                   QHVVYKEAKIK"
     MAKKGIREKI RLVSTANTGH FYTTDKNKRN MPGKFEIKKF DPVVRQHVVY KEAKIK            56
//

If you have problems or comments...

PBIL Back to PBIL home page