(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0288

BA000037.VV0288      Location/Qualifiers
FT   CDS             298431..298928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0288"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93052"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93052"
FT                   /db_xref="GOA:Q7MPS4"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPS4"
FT                   /protein_id="BAC93052.1"
FT                   /translation="MRVSPKRRRRWNNILIAGITFFIVIINAPTLIKTYLLDDQSTTQI
FT                   ESINGYPSLLNPETQLLSIQLSDNSLEWQKGMWVTARELSISPQEWAQRWQSLLGTQLD
FT                   DATMQKLAPQLIEPETIEVWYQDQEEPQRITFYRLTDFWVFKNWQDQWIAISVSTDYLF
FT                   PY"
     MRVSPKRRRR WNNILIAGIT FFIVIINAPT LIKTYLLDDQ STTQIESING YPSLLNPETQ        60
     LLSIQLSDNS LEWQKGMWVT ARELSISPQE WAQRWQSLLG TQLDDATMQK LAPQLIEPET       120
     IEVWYQDQEE PQRITFYRLT DFWVFKNWQD QWIAISVSTD YLFPY                       165
//

If you have problems or comments...

PBIL Back to PBIL home page