(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0296

BA000037.VV0296      Location/Qualifiers
FT   CDS             305420..305878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0296"
FT                   /product="diacylglycerol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93060"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93060"
FT                   /db_xref="GOA:Q7MPR6"
FT                   /db_xref="InterPro:IPR000829"
FT                   /db_xref="InterPro:IPR033718"
FT                   /db_xref="InterPro:IPR036945"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPR6"
FT                   /protein_id="BAC93060.1"
FT                   /translation="MQIPKINVKYPSFIDGNDKAFLSMTQPNIGKPGNTGIKRIIKATG
FT                   YSIQGLKAAFKHEAAVRQEFALLVVAIVLATWLDVSMLERITLLAVVVLVLIVELMNSA
FT                   VEAVVDRIGVEHHELSGRAKDIGSAAVLVALIFAGFTWLYIVGSHYWW"
     MQIPKINVKY PSFIDGNDKA FLSMTQPNIG KPGNTGIKRI IKATGYSIQG LKAAFKHEAA        60
     VRQEFALLVV AIVLATWLDV SMLERITLLA VVVLVLIVEL MNSAVEAVVD RIGVEHHELS       120
     GRAKDIGSAA VLVALIFAGF TWLYIVGSHY WW                                     152
//

If you have problems or comments...

PBIL Back to PBIL home page