(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0304

BA000037.VV0304      Location/Qualifiers
FT   CDS             complement(312811..313497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0304"
FT                   /product="putative WavS protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93068"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93068"
FT                   /db_xref="GOA:Q7MPQ8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPQ8"
FT                   /protein_id="BAC93068.1"
FT                   /translation="MLTQLTYCLREWDSAFFNRRIGDVSLATHNHYKDTLFDLITTKVC
FT                   SDDVNLISNLNQNGFQYCEGEITFSKMLSNHSHIDYDIADESDLPQLSSLVAGMYKYSR
FT                   FKYPWFNPEEKDLFYKTWLKKAVLGQFDDVCIIFRQKKTISGFVTLKLSSNSATIGLIG
FT                   VNDLSRGQGIGCKLIQCCESYLVNKNIQLIHVATQTSNVAAINLYIKNDFLVENTSVWL
FT                   YKSNSS"
     MLTQLTYCLR EWDSAFFNRR IGDVSLATHN HYKDTLFDLI TTKVCSDDVN LISNLNQNGF        60
     QYCEGEITFS KMLSNHSHID YDIADESDLP QLSSLVAGMY KYSRFKYPWF NPEEKDLFYK       120
     TWLKKAVLGQ FDDVCIIFRQ KKTISGFVTL KLSSNSATIG LIGVNDLSRG QGIGCKLIQC       180
     CESYLVNKNI QLIHVATQTS NVAAINLYIK NDFLVENTSV WLYKSNSS                    228
//

If you have problems or comments...

PBIL Back to PBIL home page