(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0305

BA000037.VV0305      Location/Qualifiers
FT   CDS             313601..314752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0305"
FT                   /product="lipopolysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93069"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93069"
FT                   /db_xref="GOA:Q7MPQ7"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR012749"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPQ7"
FT                   /protein_id="BAC93069.1"
FT                   /translation="MFETNYMIPFNKPPVTGEELQFIQEAISCGKLSGDGEFSRKCENW
FT                   FVSHTGTTKALLTPSCTHALEMAAMLIDIQPGDEVIMPSYTFVSTANAFVLRGAKVVFV
FT                   DIRADTMNIDESKIEVAITERTKAIVPVHYAGVACDMDTIMGLSDKYGLYVIEDAAQGM
FT                   MSTYKGRALGSIGHIGTYSFHETKNYTSGGEGGLLLVNDQSFSQRAEIIREKGTNRNQF
FT                   FRGMVDKYTWVDVGSSMLPSEIQSAYLWAQLINAKRINEKRINDWNYYFDSLLPLKEKG
FT                   LIELPNIPIECTHNAHMFYIKLPDLTQRTRFIEAMFKQGVLSVFHYIPLHSSPAGKSFG
FT                   RFNGKDIYTTMESEKLVRLPMFYGLALSERNKIISTIFDILES"
     MFETNYMIPF NKPPVTGEEL QFIQEAISCG KLSGDGEFSR KCENWFVSHT GTTKALLTPS        60
     CTHALEMAAM LIDIQPGDEV IMPSYTFVST ANAFVLRGAK VVFVDIRADT MNIDESKIEV       120
     AITERTKAIV PVHYAGVACD MDTIMGLSDK YGLYVIEDAA QGMMSTYKGR ALGSIGHIGT       180
     YSFHETKNYT SGGEGGLLLV NDQSFSQRAE IIREKGTNRN QFFRGMVDKY TWVDVGSSML       240
     PSEIQSAYLW AQLINAKRIN EKRINDWNYY FDSLLPLKEK GLIELPNIPI ECTHNAHMFY       300
     IKLPDLTQRT RFIEAMFKQG VLSVFHYIPL HSSPAGKSFG RFNGKDIYTT MESEKLVRLP       360
     MFYGLALSER NKIISTIFDI LES                                               383
//

If you have problems or comments...

PBIL Back to PBIL home page