(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0307

BA000037.VV0307      Location/Qualifiers
FT   CDS             315923..316864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0307"
FT                   /product="acyltransferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93071"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93071"
FT                   /db_xref="GOA:Q7MPQ5"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPQ5"
FT                   /protein_id="BAC93071.1"
FT                   /translation="MKFRQDINGLRAIAVLGVITFHFFPNAMPGGFSGVDVFFVISGFL
FT                   MTGIIVESINKDNFSILRFYKSRFNRIAPALVVLCITLIILGWFILMPLDYKLLGKHIT
FT                   NSILFFSNVIYLRESGYFDVSSYDKWLLHTWSLSVEWQFYLLYPCVILLLRRFFDFNII
FT                   KKAILLMTLLGFIVSAYMSYTSPNSAYYLLVSRSWQMFIGGVVYLFPFYVGDKCQIRMH
FT                   ILGIILIVFSYFFISQHLPWPGVGSLLPVIGAALILFSNYQGGFISQCGIFRSIGSWSY
FT                   SIYIWHWPVVVFYITMIFKAIIFYSVYLALYY"
     MKFRQDINGL RAIAVLGVIT FHFFPNAMPG GFSGVDVFFV ISGFLMTGII VESINKDNFS        60
     ILRFYKSRFN RIAPALVVLC ITLIILGWFI LMPLDYKLLG KHITNSILFF SNVIYLRESG       120
     YFDVSSYDKW LLHTWSLSVE WQFYLLYPCV ILLLRRFFDF NIIKKAILLM TLLGFIVSAY       180
     MSYTSPNSAY YLLVSRSWQM FIGGVVYLFP FYVGDKCQIR MHILGIILIV FSYFFISQHL       240
     PWPGVGSLLP VIGAALILFS NYQGGFISQC GIFRSIGSWS YSIYIWHWPV VVFYITMIFK       300
     AIIFYSVYLA LYY                                                          313
//

If you have problems or comments...

PBIL Back to PBIL home page