(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0320

BA000037.VV0320      Location/Qualifiers
FT   CDS             328252..329520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0320"
FT                   /product="putitive LPS biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93084"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93084"
FT                   /db_xref="InterPro:IPR020022"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPP2"
FT                   /protein_id="BAC93084.1"
FT                   /translation="MKYCKRCLYPENHALNLIFDVDGVCSGCRVHEEKYQIDWNEKQNE
FT                   LQKLLEHYKGRPGSHYDCVIPVSGVGDDFFVVDLIKNKYGLNPLLVTYNTHFSTKVGVR
FT                   NLARLITELDCDHMMSTVGPDTVKEITRLTLDKLGDMYWHVLAGSQTFPVQVATKLDIP
FT                   LIIWGVNGWLDQVGMFSHHDRVEMTKKVRKEHALRGIDAEHLIGTSEKVSAKDLQAFTY
FT                   PSDEQLESSRVRGLYIGNYVFWDSQKQIENVIKRFGYETNQQERTYNKYESIACANNAS
FT                   VHDYVKFLKFGYAKVNDHVARDIRLKRITREQGLSLIKEYLPRKPESLNTFLEWIELTE
FT                   KEFHQAIDKFRDPRAWEKVGNNWVLKDSVLDIDLANSEQELIVEDPREYIQTKLLEEQS
FT                   FEDEYILLGRTYIDEANYKAKEG"
     MKYCKRCLYP ENHALNLIFD VDGVCSGCRV HEEKYQIDWN EKQNELQKLL EHYKGRPGSH        60
     YDCVIPVSGV GDDFFVVDLI KNKYGLNPLL VTYNTHFSTK VGVRNLARLI TELDCDHMMS       120
     TVGPDTVKEI TRLTLDKLGD MYWHVLAGSQ TFPVQVATKL DIPLIIWGVN GWLDQVGMFS       180
     HHDRVEMTKK VRKEHALRGI DAEHLIGTSE KVSAKDLQAF TYPSDEQLES SRVRGLYIGN       240
     YVFWDSQKQI ENVIKRFGYE TNQQERTYNK YESIACANNA SVHDYVKFLK FGYAKVNDHV       300
     ARDIRLKRIT REQGLSLIKE YLPRKPESLN TFLEWIELTE KEFHQAIDKF RDPRAWEKVG       360
     NNWVLKDSVL DIDLANSEQE LIVEDPREYI QTKLLEEQSF EDEYILLGRT YIDEANYKAK       420
     EG                                                                      422
//

If you have problems or comments...

PBIL Back to PBIL home page