(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0321

BA000037.VV0321      Location/Qualifiers
FT   CDS             329524..330660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0321"
FT                   /product="putitive LPS biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93085"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93085"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020022"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPP1"
FT                   /protein_id="BAC93085.1"
FT                   /translation="MKFCSNCVMPDTKPGIVLDERGFCNACRTKEVKEKIDWTARYNDL
FT                   SLIVEDIKAQNNPFYDCIVAVSGGKDSWYQAAVLAEEFGLKVLCVTLAAHLPTTEGIDN
FT                   LNEMIKDLNVDHMKITIKPSVFRKIRRKCFLRQGEPNWAEHCAMFSSVVNTALIYDVPL
FT                   VVWGEDIAFEFGGLQRSESKPSAIAINKSDLIKEKTIHDWLDNDISERDIFFYKYPDYQ
FT                   KLQDAGVKSIYLGHFVRWYGRQNYEFVKKRGFTGRREGPLPGNFLDYDNIDEKLCEINI
FT                   WFKYLKFGFWRATDQTCYDIWNDRMTRDEAVDIVNRLQAEFPSNDFEHFLRFHDITEEQ
FT                   FWETVEKFRNHDIWEQVDGEWKLKYTLEKSQSDEASNA"
     MKFCSNCVMP DTKPGIVLDE RGFCNACRTK EVKEKIDWTA RYNDLSLIVE DIKAQNNPFY        60
     DCIVAVSGGK DSWYQAAVLA EEFGLKVLCV TLAAHLPTTE GIDNLNEMIK DLNVDHMKIT       120
     IKPSVFRKIR RKCFLRQGEP NWAEHCAMFS SVVNTALIYD VPLVVWGEDI AFEFGGLQRS       180
     ESKPSAIAIN KSDLIKEKTI HDWLDNDISE RDIFFYKYPD YQKLQDAGVK SIYLGHFVRW       240
     YGRQNYEFVK KRGFTGRREG PLPGNFLDYD NIDEKLCEIN IWFKYLKFGF WRATDQTCYD       300
     IWNDRMTRDE AVDIVNRLQA EFPSNDFEHF LRFHDITEEQ FWETVEKFRN HDIWEQVDGE       360
     WKLKYTLEKS QSDEASNA                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page