(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0328

BA000037.VV0328      Location/Qualifiers
FT   CDS             complement(336987..339236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0328"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93092"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93092"
FT                   /db_xref="InterPro:IPR010344"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPN5"
FT                   /protein_id="BAC93092.1"
FT                   /translation="MTYFNSSSEIPSVGFRSQISAVCLGVLSALAGVTSLHSQASELET
FT                   VTLRPSQTDFGGVGLMQMPSGRMAKEGEFNFGVNLNDDYHHYYTSLQLFDWFETTIRYT
FT                   RIPDTLYNPNPDYSGDNLNTDKGIDIKFRLWQESYWLPETSIGIRDIGGTGLFDGEFIA
FT                   GTKRFGPLDVTLGVGWGYIGQSGNISNPFCKVSEEYCDRDGPTKGTGGSVDFGRWFKGE
FT                   ASIYGGIEYQTPYQPLRLKVEYDANDYTTDYPVRAVNKPMPQHTPWNFGVLYQLGDWGD
FT                   AKLSYQRGDTLTFGFNLYTNFEDLKAVWRDEPKQAVTGRPSEGNTDWQAVAQQLDSNAG
FT                   YQQSTLYEQGDALVIAGEQVKYRDRKEAQDRAAAILANNAPDYITTYKIVDTRNGVDLT
FT                   QTEFDAEAYKQAATYQYLGANSRELGSTSEPDYRENAKPLTTHRERWNAGISPVLAQSL
FT                   GGPEAFYLFHLGFNTEANYWLTDNIEASGSIYVNLADNYDKFNYVEKDPHISNFAVPRV
FT                   RTMFRSYVSDNPVRLNHMQLTWFAQPTQQVYTQMYGGYLETMFAGVGGEVLYRPLGKNW
FT                   ALGLDANLISQRDPDSWFATFDEPFVYYDGYDASNCKPNDVGCQAYVLDKGTTGQLSAY
FT                   YMPQWSLLENTLFKVSAGKFLGGDNGVRVDFSKQFKSGMIVGAFATVTDLTTEEYGEGS
FT                   YNKGFYISIPFDAMTIKPSTARGVFAWQPITRDGGQTLSRKYELFEVTNARSRWY"
     MTYFNSSSEI PSVGFRSQIS AVCLGVLSAL AGVTSLHSQA SELETVTLRP SQTDFGGVGL        60
     MQMPSGRMAK EGEFNFGVNL NDDYHHYYTS LQLFDWFETT IRYTRIPDTL YNPNPDYSGD       120
     NLNTDKGIDI KFRLWQESYW LPETSIGIRD IGGTGLFDGE FIAGTKRFGP LDVTLGVGWG       180
     YIGQSGNISN PFCKVSEEYC DRDGPTKGTG GSVDFGRWFK GEASIYGGIE YQTPYQPLRL       240
     KVEYDANDYT TDYPVRAVNK PMPQHTPWNF GVLYQLGDWG DAKLSYQRGD TLTFGFNLYT       300
     NFEDLKAVWR DEPKQAVTGR PSEGNTDWQA VAQQLDSNAG YQQSTLYEQG DALVIAGEQV       360
     KYRDRKEAQD RAAAILANNA PDYITTYKIV DTRNGVDLTQ TEFDAEAYKQ AATYQYLGAN       420
     SRELGSTSEP DYRENAKPLT THRERWNAGI SPVLAQSLGG PEAFYLFHLG FNTEANYWLT       480
     DNIEASGSIY VNLADNYDKF NYVEKDPHIS NFAVPRVRTM FRSYVSDNPV RLNHMQLTWF       540
     AQPTQQVYTQ MYGGYLETMF AGVGGEVLYR PLGKNWALGL DANLISQRDP DSWFATFDEP       600
     FVYYDGYDAS NCKPNDVGCQ AYVLDKGTTG QLSAYYMPQW SLLENTLFKV SAGKFLGGDN       660
     GVRVDFSKQF KSGMIVGAFA TVTDLTTEEY GEGSYNKGFY ISIPFDAMTI KPSTARGVFA       720
     WQPITRDGGQ TLSRKYELFE VTNARSRWY                                         749
//

If you have problems or comments...

PBIL Back to PBIL home page