(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0330

BA000037.VV0330      Location/Qualifiers
FT   CDS             complement(340033..340764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0330"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93094"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93094"
FT                   /db_xref="InterPro:IPR021308"
FT                   /db_xref="InterPro:IPR023373"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPN3"
FT                   /protein_id="BAC93094.1"
FT                   /translation="MINLPFQQAILPRFLMRSAAVASLILLSGCVQRFDDMSTTLNEAF
FT                   FGAEDITQTSQQVLALPYASTYMRINDGQRIFMVLGYAEQNPENNQLQLKWVSSDGGMI
FT                   VTENGRVVKTLNLPYGNLIRREVDLAHSQQAKPWQTNLQWQSQYDWKTQGSNSNKGMHY
FT                   GYLGNVTLTQMGSEEAISAIWQQTLTIWQENIFFPQLDTTVQNQYWVNDSGQVMKSIQY
FT                   LGPEMTRIEFEILKPFAEVAQ"
     MINLPFQQAI LPRFLMRSAA VASLILLSGC VQRFDDMSTT LNEAFFGAED ITQTSQQVLA        60
     LPYASTYMRI NDGQRIFMVL GYAEQNPENN QLQLKWVSSD GGMIVTENGR VVKTLNLPYG       120
     NLIRREVDLA HSQQAKPWQT NLQWQSQYDW KTQGSNSNKG MHYGYLGNVT LTQMGSEEAI       180
     SAIWQQTLTI WQENIFFPQL DTTVQNQYWV NDSGQVMKSI QYLGPEMTRI EFEILKPFAE       240
     VAQ                                                                     243
//

If you have problems or comments...

PBIL Back to PBIL home page