(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0331

BA000037.VV0331      Location/Qualifiers
FT   CDS             complement(340797..341234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0331"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93095"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93095"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPN2"
FT                   /protein_id="BAC93095.1"
FT                   /translation="MTKIRKEKAELSSAAKNKKLSTLPPRPQLSFPRMRGSIHPHVPEA
FT                   AFGNVLTAADNDESETNSNTDNEVPKPSHGAYYTMGPRVREDDGVRESMVNLLSLTHAT
FT                   ANAKDNSCANNDGNIEASLDDCLISPFLITPSIVPLNTIFY"
     MTKIRKEKAE LSSAAKNKKL STLPPRPQLS FPRMRGSIHP HVPEAAFGNV LTAADNDESE        60
     TNSNTDNEVP KPSHGAYYTM GPRVREDDGV RESMVNLLSL THATANAKDN SCANNDGNIE       120
     ASLDDCLISP FLITPSIVPL NTIFY                                             145
//

If you have problems or comments...

PBIL Back to PBIL home page