(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0338

BA000037.VV0338      Location/Qualifiers
FT   CDS             345316..345687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0338"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93102"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93102"
FT                   /db_xref="InterPro:IPR012657"
FT                   /db_xref="InterPro:IPR036583"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPM5"
FT                   /protein_id="BAC93102.1"
FT                   /translation="MRYKELEIWKRSYQVVLQVYNLLKTCRDYGLKDQISRSAVSVPSN
FT                   IAEGSERGSYKDNIRFLYIAKGSCAELATQISLAADLGYIPIEAGQKLESEILEIGRMI
FT                   GGYIKFLSQHVKEESAEYF"
     MRYKELEIWK RSYQVVLQVY NLLKTCRDYG LKDQISRSAV SVPSNIAEGS ERGSYKDNIR        60
     FLYIAKGSCA ELATQISLAA DLGYIPIEAG QKLESEILEI GRMIGGYIKF LSQHVKEESA       120
     EYF                                                                     123
//

If you have problems or comments...

PBIL Back to PBIL home page