(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0340

BA000037.VV0340      Location/Qualifiers
FT   CDS             346520..348700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0340"
FT                   /product="putative tyrosine-protein kinase Wzc"
FT                   /note="surface assembly of capsular antigen"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93104"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93104"
FT                   /db_xref="GOA:Q7MPM3"
FT                   /db_xref="InterPro:IPR003856"
FT                   /db_xref="InterPro:IPR005702"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032807"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPM3"
FT                   /protein_id="BAC93104.1"
FT                   /translation="MNETMTTPQNRSSVDNSSDEIDLGKLLGILLDAKWIILVTTFLFA
FT                   VGGVAVALLSTPIYKADALIQIEQKSSGGISSLVGDMGELFSQESSATTEIEIIKSRMI
FT                   LGDTVDKFNLTTVAEPKYLPVIGKGLARIAGKVNQIEISRYTVPEYAQEMKHTLVVLDA
FT                   EKKTYQLVRGDEQVVLQGAAGELAKKDGYELFVTELRSHNEQEFSLSQQSRLEAIEWLK
FT                   KNLAISERGKQTGILMLSFEGENRKQISEILNHISQTYFLQNVERNSAEAEKSLTFLKG
FT                   HLPDIKNSLTTAEDTLNRFRQDNESIDLGLEAKSTLDVMVKLEAQLNELTFKESEISQR
FT                   FTKDHPAYRSLLDKRETLLKERERLNQQVQKLPKTQREVLRMTRDVEVNQQIYIQLLNK
FT                   VQELSIIKAGTVGNVRILDEAQSYAKPVKPKKPLIVVLATLLGGMLSVALVLVKAAFHR
FT                   GVENPDEIEQIGLSVYASVPKSNLQLELANKLARKKRNTDLTLLAESNPADLSIEALRG
FT                   LRTSLHFAMMEAKNNVLMISGPAPGIGKSFVSTNFAAVAAKTGQKVLLIDADMRKGYLQ
FT                   QCFGLNWENGLSDLLSGKVTRDVAVQSAKVENLDIITRGQVPPNPSELLMHPRFKELVD
FT                   WASENYDLVIVDTPPVLAVTDPSIVGAIAGTTLMVARFGQNTVKEIDVARSRFEQAGIE
FT                   VKGVILNAIEKKASSSYGYGYYNYSYGESNKA"
     MNETMTTPQN RSSVDNSSDE IDLGKLLGIL LDAKWIILVT TFLFAVGGVA VALLSTPIYK        60
     ADALIQIEQK SSGGISSLVG DMGELFSQES SATTEIEIIK SRMILGDTVD KFNLTTVAEP       120
     KYLPVIGKGL ARIAGKVNQI EISRYTVPEY AQEMKHTLVV LDAEKKTYQL VRGDEQVVLQ       180
     GAAGELAKKD GYELFVTELR SHNEQEFSLS QQSRLEAIEW LKKNLAISER GKQTGILMLS       240
     FEGENRKQIS EILNHISQTY FLQNVERNSA EAEKSLTFLK GHLPDIKNSL TTAEDTLNRF       300
     RQDNESIDLG LEAKSTLDVM VKLEAQLNEL TFKESEISQR FTKDHPAYRS LLDKRETLLK       360
     ERERLNQQVQ KLPKTQREVL RMTRDVEVNQ QIYIQLLNKV QELSIIKAGT VGNVRILDEA       420
     QSYAKPVKPK KPLIVVLATL LGGMLSVALV LVKAAFHRGV ENPDEIEQIG LSVYASVPKS       480
     NLQLELANKL ARKKRNTDLT LLAESNPADL SIEALRGLRT SLHFAMMEAK NNVLMISGPA       540
     PGIGKSFVST NFAAVAAKTG QKVLLIDADM RKGYLQQCFG LNWENGLSDL LSGKVTRDVA       600
     VQSAKVENLD IITRGQVPPN PSELLMHPRF KELVDWASEN YDLVIVDTPP VLAVTDPSIV       660
     GAIAGTTLMV ARFGQNTVKE IDVARSRFEQ AGIEVKGVIL NAIEKKASSS YGYGYYNYSY       720
     GESNKA                                                                  726
//

If you have problems or comments...

PBIL Back to PBIL home page