(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0343

BA000037.VV0343      Location/Qualifiers
FT   CDS             351200..352519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0343"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93107"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93107"
FT                   /db_xref="GOA:Q7MPM0"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPM0"
FT                   /protein_id="BAC93107.1"
FT                   /translation="MGQIYSTKKIRFSQSMSSLKSNITKGALWQSISIVSTFILIPISI
FT                   SYLGKEDYGLWIVLYSFILLLQSCDLGISSSCRNSLTKLLTQNNKVEAKYLLSTSYVIL
FT                   AGLSLGLLAFIYIIQKTVGIDALQAFPISIFAPILCVVLLDYNLKLVLTVYTSNHKAFV
FT                   LPLSTAMANVLFLMVVATLHFLDVGESNRLILFCFILPVCSLITNAFITLHAYNNGFKF
FT                   LKPSIFFFKKDYFQPLVLSGVSFFVIQVSMAILTQYASILVFEYSSSEVVADLSILDKF
FT                   FGMISVVGAVLLFPFWSKFTQKYTERDFDWIRKCILKLELFFIFTCFCVLILWYLFPFF
FT                   LDVWMTDNDEIAPSLSTIVAIKYLMIFLNSIYSYYLNGIGKLKIQIILYSLGATFIIPI
FT                   SSMLFQVFGVEGVVGYSVLIYFLLAISQKTYIVLSLKGER"
     MGQIYSTKKI RFSQSMSSLK SNITKGALWQ SISIVSTFIL IPISISYLGK EDYGLWIVLY        60
     SFILLLQSCD LGISSSCRNS LTKLLTQNNK VEAKYLLSTS YVILAGLSLG LLAFIYIIQK       120
     TVGIDALQAF PISIFAPILC VVLLDYNLKL VLTVYTSNHK AFVLPLSTAM ANVLFLMVVA       180
     TLHFLDVGES NRLILFCFIL PVCSLITNAF ITLHAYNNGF KFLKPSIFFF KKDYFQPLVL       240
     SGVSFFVIQV SMAILTQYAS ILVFEYSSSE VVADLSILDK FFGMISVVGA VLLFPFWSKF       300
     TQKYTERDFD WIRKCILKLE LFFIFTCFCV LILWYLFPFF LDVWMTDNDE IAPSLSTIVA       360
     IKYLMIFLNS IYSYYLNGIG KLKIQIILYS LGATFIIPIS SMLFQVFGVE GVVGYSVLIY       420
     FLLAISQKTY IVLSLKGER                                                    439
//

If you have problems or comments...

PBIL Back to PBIL home page