(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0347

BA000037.VV0347      Location/Qualifiers
FT   CDS             355295..356344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0347"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93111"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93111"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPL6"
FT                   /protein_id="BAC93111.1"
FT                   /translation="MKVMRKVLFLYSEIGPYNIPVFEELSKTFNCDIHVVRWDKNCLKP
FT                   YSPKRIDHVTYYKRSKFDENKLKDLIEFINPEIIYVSGWMDNLYLKIVEPIKPKGIPIV
FT                   IGFDDIWTGSLRQVLGQYYFRVRLNKYFSHAWVAGEAQYEFARRLGFSRENIIFDLLSA
FT                   DIKNFSSVKYNENANFFLYVGNFRKVKGTDLLAKSFKFYRDELNGNFKLLCIGNGELIS
FT                   ALSDNSNIIVQGYTEQSELIKAIGQASAFILPSRHDQWGVVAHEFATAGLPLIMSTGVG
FT                   ARSKFLINGYNGFVFENGSSLDLAHKMKAFESISSEEKSNMSKRSRELGTRISPQSSAA
FT                   SFMSLLGYK"
     MKVMRKVLFL YSEIGPYNIP VFEELSKTFN CDIHVVRWDK NCLKPYSPKR IDHVTYYKRS        60
     KFDENKLKDL IEFINPEIIY VSGWMDNLYL KIVEPIKPKG IPIVIGFDDI WTGSLRQVLG       120
     QYYFRVRLNK YFSHAWVAGE AQYEFARRLG FSRENIIFDL LSADIKNFSS VKYNENANFF       180
     LYVGNFRKVK GTDLLAKSFK FYRDELNGNF KLLCIGNGEL ISALSDNSNI IVQGYTEQSE       240
     LIKAIGQASA FILPSRHDQW GVVAHEFATA GLPLIMSTGV GARSKFLING YNGFVFENGS       300
     SLDLAHKMKA FESISSEEKS NMSKRSRELG TRISPQSSAA SFMSLLGYK                   349
//

If you have problems or comments...

PBIL Back to PBIL home page