(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0348

BA000037.VV0348      Location/Qualifiers
FT   CDS             356341..357423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0348"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93112"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93112"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPL5"
FT                   /protein_id="BAC93112.1"
FT                   /translation="MNKLLINFFSAKSGGGKVILDNFMEHFDADDVEIHFIFPSEYDFK
FT                   FEKHLEVKVPKWMNKPYGLFWFYFFFVPNYCRKNGISKVLNFGDVIFPRLKSQTYFFDW
FT                   AYLVLDDSNIWSSMDFKSRFIRMLKAALIKAFKSNNKTVIVQSEAISSSYKKILGFEGE
FT                   IVVAPTPVSINNIDGMSHGIDKNSLVYISNYAPHKNFEIIPRVASILKQNKVDCSIVLT
FT                   IDENSIHWRNLSCELSGLGVLDMVKTLGPLSQEDVFSVLKSSRALFFPSKLESYGIPLI
FT                   EAMILGKPVLTSDTPFIKSVCGDAVLYFDPKCPEDIATKITDFIDGVDYCRMRQSEVSK
FT                   VLENIPSWDQYTRLLIKSSI"
     MNKLLINFFS AKSGGGKVIL DNFMEHFDAD DVEIHFIFPS EYDFKFEKHL EVKVPKWMNK        60
     PYGLFWFYFF FVPNYCRKNG ISKVLNFGDV IFPRLKSQTY FFDWAYLVLD DSNIWSSMDF       120
     KSRFIRMLKA ALIKAFKSNN KTVIVQSEAI SSSYKKILGF EGEIVVAPTP VSINNIDGMS       180
     HGIDKNSLVY ISNYAPHKNF EIIPRVASIL KQNKVDCSIV LTIDENSIHW RNLSCELSGL       240
     GVLDMVKTLG PLSQEDVFSV LKSSRALFFP SKLESYGIPL IEAMILGKPV LTSDTPFIKS       300
     VCGDAVLYFD PKCPEDIATK ITDFIDGVDY CRMRQSEVSK VLENIPSWDQ YTRLLIKSSI       360
//

If you have problems or comments...

PBIL Back to PBIL home page