(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0354

BA000037.VV0354      Location/Qualifiers
FT   CDS             362904..364055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0354"
FT                   /product="putitive LPS biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93118"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93118"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020022"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPK9"
FT                   /protein_id="BAC93118.1"
FT                   /translation="MIIMTKNRENQICTNCVMDTTDSKITFDSKGVCDHCNDFYENVQP
FT                   NWHTDEKGHLELERIITKIKKDGEGRDFDCIMGMSGGADSSYLLHVAVKKYGLRPLVFH
FT                   VDGGWNSQIAVNNINVMIEKLGLDLYTEVINWEEMKAFQKAYFKAGVSNIDIPQDHAFI
FT                   ATLYNFAAKHKIKYILNGGNISTECVRNPLEWIYYGTDMAQIKDIRKRFCDNSLKTYPF
FT                   SNVLKHKLYLRYIQRIQVVKPLNYFPYIKEEAMKELEREYGWVPYPQKHFESRFTRFYE
FT                   GYWLPRKFGYDTRKVQYSSLILTGQMTREEAIEKLKFPAITDEDGKHDLEYIANKLDIP
FT                   VSELQSYFEQPNKTYKDYNNQESMFEFGAKVLRWLGVERSIKR"
     MIIMTKNREN QICTNCVMDT TDSKITFDSK GVCDHCNDFY ENVQPNWHTD EKGHLELERI        60
     ITKIKKDGEG RDFDCIMGMS GGADSSYLLH VAVKKYGLRP LVFHVDGGWN SQIAVNNINV       120
     MIEKLGLDLY TEVINWEEMK AFQKAYFKAG VSNIDIPQDH AFIATLYNFA AKHKIKYILN       180
     GGNISTECVR NPLEWIYYGT DMAQIKDIRK RFCDNSLKTY PFSNVLKHKL YLRYIQRIQV       240
     VKPLNYFPYI KEEAMKELER EYGWVPYPQK HFESRFTRFY EGYWLPRKFG YDTRKVQYSS       300
     LILTGQMTRE EAIEKLKFPA ITDEDGKHDL EYIANKLDIP VSELQSYFEQ PNKTYKDYNN       360
     QESMFEFGAK VLRWLGVERS IKR                                               383
//

If you have problems or comments...

PBIL Back to PBIL home page