(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0358

BA000037.VV0358      Location/Qualifiers
FT   CDS             367623..369434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0358"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93122"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93122"
FT                   /db_xref="GOA:Q7MPK5"
FT                   /db_xref="InterPro:IPR008929"
FT                   /db_xref="InterPro:IPR012480"
FT                   /db_xref="InterPro:IPR031680"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPK5"
FT                   /protein_id="BAC93122.1"
FT                   /translation="MSLKLKAQTAIDLGLLNLARVAGYQLGVRSGLNPVKRLSQAPVSG
FT                   LLFRPLSTLVQCESSQRYQFSPFGWKPKRFVSELRWAESTLTGQIYSNMEKPWFSLSDF
FT                   DSNVGDIKGIWEASRFDWVLGLAKDYLSGREQALDELNATAKDWLEHNPPYLGPNWKCG
FT                   QEASIRVMHLAMTAKLLNQVERSEPALLAFVKAHLKRIAPTISYAVAQDNNHGTSEAAA
FT                   LFIGGSWLVSNGNKSAVRWQKMGRKWLENRVKHLIDDDGTFSQYSVNYHRVMLDTYSMA
FT                   ELWRRELNLKSFSPSLYTRIGLATHWLYQLTQEDNGDAPNLGHNDGARLLPLSDTDYRD
FT                   FRPTVQLASILFLQSSAWEKAGSYDEPLKLLGLSKPKQALNKPSSFHFAQGGYAGLRSQ
FT                   TGAFVLFNYPIFRFRPAQNDALHVDFWLDGVNLLRDGGTFSYNAGQAYIDYYGGTQSHN
FT                   TVQFDEHEQMPRLSRFLLGAWLKAENVHWDEARQYCSASYRDYFGCGHKRYVSLSNSTL
FT                   RVVDDIHGVQKKAILRWRLNPGKWIIEGNRVTNHTHSITISSNTDIKRLELVEGKESRY
FT                   YYQETSIPVLEIEVTSDGQITTEYNYS"
     MSLKLKAQTA IDLGLLNLAR VAGYQLGVRS GLNPVKRLSQ APVSGLLFRP LSTLVQCESS        60
     QRYQFSPFGW KPKRFVSELR WAESTLTGQI YSNMEKPWFS LSDFDSNVGD IKGIWEASRF       120
     DWVLGLAKDY LSGREQALDE LNATAKDWLE HNPPYLGPNW KCGQEASIRV MHLAMTAKLL       180
     NQVERSEPAL LAFVKAHLKR IAPTISYAVA QDNNHGTSEA AALFIGGSWL VSNGNKSAVR       240
     WQKMGRKWLE NRVKHLIDDD GTFSQYSVNY HRVMLDTYSM AELWRRELNL KSFSPSLYTR       300
     IGLATHWLYQ LTQEDNGDAP NLGHNDGARL LPLSDTDYRD FRPTVQLASI LFLQSSAWEK       360
     AGSYDEPLKL LGLSKPKQAL NKPSSFHFAQ GGYAGLRSQT GAFVLFNYPI FRFRPAQNDA       420
     LHVDFWLDGV NLLRDGGTFS YNAGQAYIDY YGGTQSHNTV QFDEHEQMPR LSRFLLGAWL       480
     KAENVHWDEA RQYCSASYRD YFGCGHKRYV SLSNSTLRVV DDIHGVQKKA ILRWRLNPGK       540
     WIIEGNRVTN HTHSITISSN TDIKRLELVE GKESRYYYQE TSIPVLEIEV TSDGQITTEY       600
     NYS                                                                     603
//

If you have problems or comments...

PBIL Back to PBIL home page