(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0378

BA000037.VV0378      Location/Qualifiers
FT   CDS             385930..386754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0378"
FT                   /product="ribosomal protein L2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93142"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93142"
FT                   /db_xref="GOA:Q7MPI5"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MPI5"
FT                   /protein_id="BAC93142.1"
FT                   /translation="MAIVKCKPTSAGRRHVVKVVNADLHKGKPYAPLLEKNSKNGGRNN
FT                   NGRITVRHIGGGHKQHYRVVDFKRTKDGIPAKVERLEYDPNRSANIALVLYADGERRYI
FT                   IAPKGMQAGDVIQSGVDAPIKAGNTLPMRNIPVGSTIHCVELTPGKGAQLARSAGAYAQ
FT                   LVARDGSYVTIRLRSGEMRKVLSEGRATIGEVGNSEHMLRELGKAGASRWRGVRPTVRG
FT                   VVMNPVDHPHGGGEGRTSGGRHPVSPWGVPTKGYKTRSNKRTDKYIVRRRNK"
     MAIVKCKPTS AGRRHVVKVV NADLHKGKPY APLLEKNSKN GGRNNNGRIT VRHIGGGHKQ        60
     HYRVVDFKRT KDGIPAKVER LEYDPNRSAN IALVLYADGE RRYIIAPKGM QAGDVIQSGV       120
     DAPIKAGNTL PMRNIPVGST IHCVELTPGK GAQLARSAGA YAQLVARDGS YVTIRLRSGE       180
     MRKVLSEGRA TIGEVGNSEH MLRELGKAGA SRWRGVRPTV RGVVMNPVDH PHGGGEGRTS       240
     GGRHPVSPWG VPTKGYKTRS NKRTDKYIVR RRNK                                   274
//

If you have problems or comments...

PBIL Back to PBIL home page