(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0382

BA000037.VV0382      Location/Qualifiers
FT   CDS             388129..388539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0382"
FT                   /product="ribosomal protein L16/L10E"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93146"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93146"
FT                   /db_xref="GOA:Q7MPI1"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MPI1"
FT                   /protein_id="BAC93146.1"
FT                   /translation="MLQPKRTKFRKVHTGRNRGLAKGTEVSFGSFGLKAVGRGRLTARQ
FT                   IEAARRAMTRHIKRQGKIWIRVFPDKPITEKPLEVRQGKGKGNVEYWVAQIQPGKVMYE
FT                   VDGVPEELAREAFRLAARKLPFKTTFVTKQVM"
     MLQPKRTKFR KVHTGRNRGL AKGTEVSFGS FGLKAVGRGR LTARQIEAAR RAMTRHIKRQ        60
     GKIWIRVFPD KPITEKPLEV RQGKGKGNVE YWVAQIQPGK VMYEVDGVPE ELAREAFRLA       120
     ARKLPFKTTF VTKQVM                                                       136
//

If you have problems or comments...

PBIL Back to PBIL home page