(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0383

BA000037.VV0383      Location/Qualifiers
FT   CDS             388536..388730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0383"
FT                   /product="ribosomal protein L29"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93147"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93147"
FT                   /db_xref="GOA:Q7MPI0"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MPI0"
FT                   /protein_id="BAC93147.1"
FT                   /translation="MMKAQDLREKSVEELNSELLNLLREQFNLRMQAATGQLQQTHTLK
FT                   AVRRDIARVKTVLTEKAGA"
     MMKAQDLREK SVEELNSELL NLLREQFNLR MQAATGQLQQ THTLKAVRRD IARVKTVLTE        60
     KAGA                                                                     64
//

If you have problems or comments...

PBIL Back to PBIL home page