(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0384

BA000037.VV0384      Location/Qualifiers
FT   CDS             388730..388984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0384"
FT                   /product="ribosomal protein S17"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93148"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93148"
FT                   /db_xref="GOA:Q7MPH9"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MPH9"
FT                   /protein_id="BAC93148.1"
FT                   /translation="MSDKIRTQLGRVVSDKMDKSIVVAIERMVKHPIYGKFVKRTTKVH
FT                   AHDENNECGIGDTVEIRECRPLSKTKSWTLVKVVEKAKI"
     MSDKIRTQLG RVVSDKMDKS IVVAIERMVK HPIYGKFVKR TTKVHAHDEN NECGIGDTVE        60
     IRECRPLSKT KSWTLVKVVE KAKI                                               84
//

If you have problems or comments...

PBIL Back to PBIL home page