(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0386

BA000037.VV0386      Location/Qualifiers
FT   CDS             389532..389849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0386"
FT                   /product="ribosomal protein L24"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93150"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93150"
FT                   /db_xref="GOA:Q7MPH7"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MPH7"
FT                   /protein_id="BAC93150.1"
FT                   /translation="MAAKIRRNDEVIVLAGKDKGKKGKVTKVLATGKVIVEGINLVKKH
FT                   QKPVPALGIQGGIVEQEAAIDVSNVAIFNAATGKADRIGFRFEDGQKVRFFKSNGETVS
FT                   N"
     MAAKIRRNDE VIVLAGKDKG KKGKVTKVLA TGKVIVEGIN LVKKHQKPVP ALGIQGGIVE        60
     QEAAIDVSNV AIFNAATGKA DRIGFRFEDG QKVRFFKSNG ETVSN                       105
//

If you have problems or comments...

PBIL Back to PBIL home page