(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0387

BA000037.VV0387      Location/Qualifiers
FT   CDS             389876..390415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0387"
FT                   /product="ribosomal protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93151"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93151"
FT                   /db_xref="GOA:Q7MPH6"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MPH6"
FT                   /protein_id="BAC93151.1"
FT                   /translation="MAKLHDYYKSSVVAELTKQFGYTSVMQVPRIEKITLNMGVGDAIN
FT                   DKKLLENAAADMATISGQKPLITKARKSVAGFKIREGYPIGCKVTLRGERMWDFMERLI
FT                   SIALPRVRDFRGVNAKSFDGRGNYSMGVREQIIFPEIDFDKVDRVRGLDITITTSAGTD
FT                   EEGRALLAAFNFPFRK"
     MAKLHDYYKS SVVAELTKQF GYTSVMQVPR IEKITLNMGV GDAINDKKLL ENAAADMATI        60
     SGQKPLITKA RKSVAGFKIR EGYPIGCKVT LRGERMWDFM ERLISIALPR VRDFRGVNAK       120
     SFDGRGNYSM GVREQIIFPE IDFDKVDRVR GLDITITTSA GTDEEGRALL AAFNFPFRK        179
//

If you have problems or comments...

PBIL Back to PBIL home page