(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0388

BA000037.VV0388      Location/Qualifiers
FT   CDS             390433..390738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0388"
FT                   /product="ribosomal protein S14"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93152"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93152"
FT                   /db_xref="GOA:Q7MPH5"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023036"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MPH5"
FT                   /protein_id="BAC93152.1"
FT                   /translation="MAKQSMKAREAKRAKLVAKFAEKRASLKAIISDVNVSEEDRWNAV
FT                   LKLQTLPRDSSASRQRNRCNQTGRPHGYLRKFGLSRIKVREACMKGEIPGLRKASW"
     MAKQSMKARE AKRAKLVAKF AEKRASLKAI ISDVNVSEED RWNAVLKLQT LPRDSSASRQ        60
     RNRCNQTGRP HGYLRKFGLS RIKVREACMK GEIPGLRKAS W                           101
//

If you have problems or comments...

PBIL Back to PBIL home page