(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0392

BA000037.VV0392      Location/Qualifiers
FT   CDS             392085..392588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0392"
FT                   /product="ribosomal protein S5"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93156"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93156"
FT                   /db_xref="GOA:Q7MPH1"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MPH1"
FT                   /protein_id="BAC93156.1"
FT                   /translation="MAKEQQVQANDLQEKLIAVNRVSKTVKGGRIMSFTALTVVGDGNG
FT                   RVGFGYGKAREVPAAIQKAMEKARRNMVTIALNEGTLHHPVKGRHSGSKVYMQPAAEGT
FT                   GVIAGGAMRAVLEVAGVHNVLSKAYGSTNPINIVRATIDALVDVKSPEMVAAKRGLTVE
FT                   AISE"
     MAKEQQVQAN DLQEKLIAVN RVSKTVKGGR IMSFTALTVV GDGNGRVGFG YGKAREVPAA        60
     IQKAMEKARR NMVTIALNEG TLHHPVKGRH SGSKVYMQPA AEGTGVIAGG AMRAVLEVAG       120
     VHNVLSKAYG STNPINIVRA TIDALVDVKS PEMVAAKRGL TVEAISE                     167
//

If you have problems or comments...

PBIL Back to PBIL home page