(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0393

BA000037.VV0393      Location/Qualifiers
FT   CDS             392596..392772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0393"
FT                   /product="ribosomal protein L30/L7E"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93157"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93157"
FT                   /db_xref="GOA:Q7MPH0"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR018038"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MPH0"
FT                   /protein_id="BAC93157.1"
FT                   /translation="MATIKVTQTKSSIGRLPKHKATLRGLGLRRINHTVELEDTPCIRG
FT                   MINKVYYMVKVEE"
     MATIKVTQTK SSIGRLPKHK ATLRGLGLRR INHTVELEDT PCIRGMINKV YYMVKVEE          58
//

If you have problems or comments...

PBIL Back to PBIL home page