(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0396

BA000037.VV0396      Location/Qualifiers
FT   CDS             394867..395223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0396"
FT                   /product="ribosomal protein S13"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93160"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93160"
FT                   /db_xref="GOA:Q7MPG7"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MPG7"
FT                   /protein_id="BAC93160.1"
FT                   /translation="MARIAGINIPDQKHAVIALTAIYGIGKTRSKAILADVGIAEDVKI
FT                   SELTEEQIDQLRDGVAKYTVEGDLRREVSMNIKRLMDLGCYRGLRHRRSLPLRGQRTKT
FT                   NARTRKGPRKPIKK"
     MARIAGINIP DQKHAVIALT AIYGIGKTRS KAILADVGIA EDVKISELTE EQIDQLRDGV        60
     AKYTVEGDLR REVSMNIKRL MDLGCYRGLR HRRSLPLRGQ RTKTNARTRK GPRKPIKK         118
//

If you have problems or comments...

PBIL Back to PBIL home page