(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0398

BA000037.VV0398      Location/Qualifiers
FT   CDS             395659..396279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0398"
FT                   /product="ribosomal protein S4"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93162"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93162"
FT                   /db_xref="GOA:Q7MPG5"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MPG5"
FT                   /protein_id="BAC93162.1"
FT                   /translation="MARYLGPKLKLSRREGTDLFLKSGVRAIDTKCKIDNAPGVHGARR
FT                   GRLSEYGVQLREKQKVRRMYGVLEKQFRNYYAEAARLKGNTGENLLQLLEGRLDNVVYR
FT                   MGFGATRAEARQLVSHKAILVNGKVVNVPSFKVAANDVVSIREKAKQQTRIKAALEVAE
FT                   QREKPTWIEVDAGKMEGTFKRMPERSDLSADINEQLIVELYSK"
     MARYLGPKLK LSRREGTDLF LKSGVRAIDT KCKIDNAPGV HGARRGRLSE YGVQLREKQK        60
     VRRMYGVLEK QFRNYYAEAA RLKGNTGENL LQLLEGRLDN VVYRMGFGAT RAEARQLVSH       120
     KAILVNGKVV NVPSFKVAAN DVVSIREKAK QQTRIKAALE VAEQREKPTW IEVDAGKMEG       180
     TFKRMPERSD LSADINEQLI VELYSK                                            206
//

If you have problems or comments...

PBIL Back to PBIL home page