(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0399

BA000037.VV0399      Location/Qualifiers
FT   CDS             396303..397295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0399"
FT                   /product="DNA-directed RNA polymerase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93163"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93163"
FT                   /db_xref="GOA:Q7MPG4"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MPG4"
FT                   /protein_id="BAC93163.1"
FT                   /translation="MQGSVTEFLKPRLVDIEQISSTHAKVTLEPLERGFGHTLGNALRR
FT                   ILLSSMPGCAVTEVEIEGVLHEYSTKEGVQEDILEILLNLKGLAVRVAEGKDEVFITLN
FT                   KSGSGPVVAGDITHDGDVEIANPEHVICHLTDDNAEIAMRIKVERGRGYVPASARIHTE
FT                   EDERPIGRLLVDATYSPVDKIAYAVEAARVEQRTDLDKLVIDMETNGTLEPEEAIRRAA
FT                   TILAEQLDAFVDLRDVRVPEEKEEKPEFDPILLRPVDDLELTVRSANCLKAEAIHYIGD
FT                   LVQRTEVELLKTPNLGKKSLTEIKDVLASRGLSLGMRLENWPPASIAED"
     MQGSVTEFLK PRLVDIEQIS STHAKVTLEP LERGFGHTLG NALRRILLSS MPGCAVTEVE        60
     IEGVLHEYST KEGVQEDILE ILLNLKGLAV RVAEGKDEVF ITLNKSGSGP VVAGDITHDG       120
     DVEIANPEHV ICHLTDDNAE IAMRIKVERG RGYVPASARI HTEEDERPIG RLLVDATYSP       180
     VDKIAYAVEA ARVEQRTDLD KLVIDMETNG TLEPEEAIRR AATILAEQLD AFVDLRDVRV       240
     PEEKEEKPEF DPILLRPVDD LELTVRSANC LKAEAIHYIG DLVQRTEVEL LKTPNLGKKS       300
     LTEIKDVLAS RGLSLGMRLE NWPPASIAED                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page