(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0401

BA000037.VV0401      Location/Qualifiers
FT   CDS             complement(398053..398547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0401"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93165"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93165"
FT                   /db_xref="InterPro:IPR021302"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPG2"
FT                   /protein_id="BAC93165.1"
FT                   /translation="MYKKIAIAAFVSVALMGCQTTSKQTQTGTESGYSEIANAALMGAV
FT                   QTWSQKGAADSDLVSAIQNSTNVSSEQAIGGIGSLLALAQNSLSSNENNELSGLIPGFD
FT                   SLQSSGLTALISNNETVKSAFSALGLDPALISTFTPIILSALQNQGASSGLLDSLSSIW
FT                   K"
     MYKKIAIAAF VSVALMGCQT TSKQTQTGTE SGYSEIANAA LMGAVQTWSQ KGAADSDLVS        60
     AIQNSTNVSS EQAIGGIGSL LALAQNSLSS NENNELSGLI PGFDSLQSSG LTALISNNET       120
     VKSAFSALGL DPALISTFTP IILSALQNQG ASSGLLDSLS SIWK                        164
//

If you have problems or comments...

PBIL Back to PBIL home page