(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0406

BA000037.VV0406      Location/Qualifiers
FT   CDS             complement(400165..401037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0406"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93169"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93169"
FT                   /db_xref="GOA:Q7MPF8"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPF8"
FT                   /protein_id="BAC93169.1"
FT                   /translation="MQAQQLAVVLLIVGNFLATLSDVAVKLIDGDISPFQYMFLRQVVS
FT                   LLLITPLWWVQSPEQRRLTQPAVTITRAHLILIGSGCMMVSITYLPLATANAVFYAAPL
FT                   LMLPLSIWLLKERPSAAKVLATSLGFVGVLIVLRPSQFHWAALFALGTATTLALFNILV
FT                   RKLPASQSVVTTLWWTTLFSIPVSALLALFHWQPMSAQLFLLVAISAVCILGYNGLAVA
FT                   AYRRAPAGQIALSEYSGLLFVTLIGVVGFNELPDGFTWLGISLIVLPLLPVREWLHARQ
FT                   RKHRSPSSS"
     MQAQQLAVVL LIVGNFLATL SDVAVKLIDG DISPFQYMFL RQVVSLLLIT PLWWVQSPEQ        60
     RRLTQPAVTI TRAHLILIGS GCMMVSITYL PLATANAVFY AAPLLMLPLS IWLLKERPSA       120
     AKVLATSLGF VGVLIVLRPS QFHWAALFAL GTATTLALFN ILVRKLPASQ SVVTTLWWTT       180
     LFSIPVSALL ALFHWQPMSA QLFLLVAISA VCILGYNGLA VAAYRRAPAG QIALSEYSGL       240
     LFVTLIGVVG FNELPDGFTW LGISLIVLPL LPVREWLHAR QRKHRSPSSS                  290
//

If you have problems or comments...

PBIL Back to PBIL home page