(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0418

BA000037.VV0418      Location/Qualifiers
FT   CDS             complement(412087..413346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0418"
FT                   /product="ABC-type antimicrobial peptide transport system,
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93182"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93182"
FT                   /db_xref="GOA:Q7MPE6"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPE6"
FT                   /protein_id="BAC93182.1"
FT                   /translation="MSATMTLAWKSLRNRKATAFLTVLTVAISVILLLGVEKIRTQAKE
FT                   SFANTISGTDLIVGGRSGQVNLLLYSVFRIGNATNNIDWKSYQDFANHRAVAWAIPISL
FT                   GDSHKGFRVMGTNHSYFEHFKYGSKQPLTFSQGKPFNGLFETVLGAEVAKQLGYQIGSE
FT                   IIIAHGISDVGFSRHDNLPFKVVGILAPTGTPVDKTVHVSLEAIEAIHVGWESGARLGP
FT                   SPDATQLEQKQFQPKQITAMMLGLKSRIQTFALQREINTYNQEPLSAIMPGVALHELWG
FT                   MMSVAEQALMAVSVFVVIAGLLGMLSSLLTSLQERRREMAILRAMGARPRHVFTLLISE
FT                   ASLLTLAGIVTGVAGVYGLLSIAQPIIQQQYGINITMTAISPHEWMLLAFVQTAGILIG
FT                   FIPAIRAYKQSLSDGMTIRI"
     MSATMTLAWK SLRNRKATAF LTVLTVAISV ILLLGVEKIR TQAKESFANT ISGTDLIVGG        60
     RSGQVNLLLY SVFRIGNATN NIDWKSYQDF ANHRAVAWAI PISLGDSHKG FRVMGTNHSY       120
     FEHFKYGSKQ PLTFSQGKPF NGLFETVLGA EVAKQLGYQI GSEIIIAHGI SDVGFSRHDN       180
     LPFKVVGILA PTGTPVDKTV HVSLEAIEAI HVGWESGARL GPSPDATQLE QKQFQPKQIT       240
     AMMLGLKSRI QTFALQREIN TYNQEPLSAI MPGVALHELW GMMSVAEQAL MAVSVFVVIA       300
     GLLGMLSSLL TSLQERRREM AILRAMGARP RHVFTLLISE ASLLTLAGIV TGVAGVYGLL       360
     SIAQPIIQQQ YGINITMTAI SPHEWMLLAF VQTAGILIGF IPAIRAYKQS LSDGMTIRI        419
//

If you have problems or comments...

PBIL Back to PBIL home page