(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0426

BA000037.VV0426      Location/Qualifiers
FT   CDS             416110..416319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0426"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93190"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93190"
FT                   /db_xref="InterPro:IPR009491"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPD8"
FT                   /protein_id="BAC93190.1"
FT                   /translation="MLREFAVYRPRQVARFVKTLFKGSFSINGIGEFEFDNGKVLLPDT
FT                   HNTQKLSVYREVNAEINALSLAAA"
     MLREFAVYRP RQVARFVKTL FKGSFSINGI GEFEFDNGKV LLPDTHNTQK LSVYREVNAE        60
     INALSLAAA                                                                69
//

If you have problems or comments...

PBIL Back to PBIL home page