(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0427

BA000037.VV0427      Location/Qualifiers
FT   CDS             complement(416424..417053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0427"
FT                   /product="Peptide methionine sulfoxide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93191"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93191"
FT                   /db_xref="GOA:Q7MPD7"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPD7"
FT                   /protein_id="BAC93191.1"
FT                   /translation="MLNKQIMVDADNALAGRQEAMAVEPIHFVNGSDITAPATQGQQEI
FT                   LLGMGCFWGAERLFWQLDGVVSTSVGYSGGFTLNPTYQEVCSGQTGHTEVVRVIFDPQV
FT                   LPLEQLLEKFWERHDPTQGMRQGNDLGTQYRSAIYTFSDQQLDIALASQQAYQAALANQ
FT                   QHNTITTEIRPAGPYFYAETYHQQYLAKNPEGYCGLGGTGVCFPPA"
     MLNKQIMVDA DNALAGRQEA MAVEPIHFVN GSDITAPATQ GQQEILLGMG CFWGAERLFW        60
     QLDGVVSTSV GYSGGFTLNP TYQEVCSGQT GHTEVVRVIF DPQVLPLEQL LEKFWERHDP       120
     TQGMRQGNDL GTQYRSAIYT FSDQQLDIAL ASQQAYQAAL ANQQHNTITT EIRPAGPYFY       180
     AETYHQQYLA KNPEGYCGLG GTGVCFPPA                                         209
//

If you have problems or comments...

PBIL Back to PBIL home page