(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0428

BA000037.VV0428      Location/Qualifiers
FT   CDS             417285..419000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0428"
FT                   /product="outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93192"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93192"
FT                   /db_xref="GOA:Q7MPD6"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="InterPro:IPR035243"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPD6"
FT                   /protein_id="BAC93192.1"
FT                   /translation="MIKKVLPLLVSSLFASNLVAAPQVSLSLEGVSGAVEENIEAHLTS
FT                   IDEKDYSTSLRFQSRLDGIINGALNALGYYHAQIDYQISDDQEELTAHITLGEPVRVET
FT                   FDVRIEGEASNDKDFLQLLEKSPLKQGAILNHGDYDTLKSSIRNLALQKGYFKGDFIET
FT                   RLEVAADLNQAFVRLHYDSGMRYHFGQTTITGSQIEENRVRSLQPFKAGDPYLVAKVGE
FT                   YNQNLSNTDWFSSVFVEPDLSSLDDTRELPMKVSLAPQAKNQIETGIGYATDVEFRGTL
FT                   KWKKPWVNELGHSFDSSLSISKPEQTVTAGYQIPLEDVLHDYYRIQYAMKHVDSRDTKS
FT                   LESNLAVERHWLLDNRWHRTVFVRYLIENYEQGLQDDVAQFVLPGVSFSRSRVRGGSMP
FT                   SWGDKQSITFEYGDDNLLSETRVLRVQGRTTWIRSLGENHRGLARLEAGANLTEEFEKL
FT                   SPSLRFFAGGDNNLRGYGYESISPKDSSGALTGAQYIATSTLEYQYRLYGNWWAAAFVD
FT                   YGDAFNDAPDWKTGTGLGIRWASPVGPIRIDFAWGLDAKPGDEFRLHFTLGPEL"
     MIKKVLPLLV SSLFASNLVA APQVSLSLEG VSGAVEENIE AHLTSIDEKD YSTSLRFQSR        60
     LDGIINGALN ALGYYHAQID YQISDDQEEL TAHITLGEPV RVETFDVRIE GEASNDKDFL       120
     QLLEKSPLKQ GAILNHGDYD TLKSSIRNLA LQKGYFKGDF IETRLEVAAD LNQAFVRLHY       180
     DSGMRYHFGQ TTITGSQIEE NRVRSLQPFK AGDPYLVAKV GEYNQNLSNT DWFSSVFVEP       240
     DLSSLDDTRE LPMKVSLAPQ AKNQIETGIG YATDVEFRGT LKWKKPWVNE LGHSFDSSLS       300
     ISKPEQTVTA GYQIPLEDVL HDYYRIQYAM KHVDSRDTKS LESNLAVERH WLLDNRWHRT       360
     VFVRYLIENY EQGLQDDVAQ FVLPGVSFSR SRVRGGSMPS WGDKQSITFE YGDDNLLSET       420
     RVLRVQGRTT WIRSLGENHR GLARLEAGAN LTEEFEKLSP SLRFFAGGDN NLRGYGYESI       480
     SPKDSSGALT GAQYIATSTL EYQYRLYGNW WAAAFVDYGD AFNDAPDWKT GTGLGIRWAS       540
     PVGPIRIDFA WGLDAKPGDE FRLHFTLGPE L                                      571
//

If you have problems or comments...

PBIL Back to PBIL home page