(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0429

BA000037.VV0429      Location/Qualifiers
FT   CDS             418997..422752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0429"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93193"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93193"
FT                   /db_xref="GOA:Q7MPD5"
FT                   /db_xref="InterPro:IPR007452"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPD5"
FT                   /protein_id="BAC93193.1"
FT                   /translation="MIKVVFKWSKWISAGVMALLVLLLTLIALLLFTHPGLTSAIWVAE
FT                   KVVPQLQVGQVQGALFPKFTLRKVTFNDAELNIASSVDELTLAMNFQCLLEPKVCINEI
FT                   SIDGLALSLPQLPPSSESVEEPSEPLKSISTPVPVFLHRLALTNIQLDVLGNQISWGEL
FT                   SSALSMQGDRLVIAPTRFSDIDVTLAPSEPQAQSAAPNDAPRQDIELPEVWIPLQIVLQ
FT                   RFDVNRFTLHQETPLIVNHLALEAKAGKNRVDVETLELDMPQVSAQANAQVELKGEYPL
FT                   SLDLKAKLKETDLKGQNITLNASQSVAHLQLQSTLSGPVSAQLSATLEPLLVSLPFDVK
FT                   LSDLQTQWPLSGESDYQIKSTNLMTQGSLEGYQLALQSQLDGKEIPAITLDVHGSGDLQ
FT                   HIDLDKLNVETLGGELKGQVMANWQSLVNWQASLQLQNIQPGLQWPEAEGNISGKLATT
FT                   GSLTEKGGWKVALPELDIDGLLRGYPLNIEGSLHASDEEGNGEVYIDTERLTLSHGPNG
FT                   LTAKGQLKKEWQMDVDIHFTDLAKSVPDLSGSVVGDVDLRGALKEPDIQLALQAQNIQW
FT                   QQQASIEQLSLTGRVTPLPEPQADVTLKVAALRYQEQLIDSILLSVSGGEKQHQLSLDV
FT                   SSDLVSTSLAIHGGLQQKPQMVWSGELERMFATTQQGTWTLQQATAIKANIDQQQVDVA
FT                   AHCWQQQGSTLCLTKDIRVGEKGEAELALNQFDFAQIAMFLPPETKLDGSVDATVWAKW
FT                   APESSPQAKVSLHLPTGQVQQKIEQVVTLGWDDINLNAQLHQDQLNADWQINVSDNGDL
FT                   TGQLQVADVQASDPQLKAKLALSQFNLDFLAPLVGEYSALKALISTDLSVSGSVYHPQV
FT                   KGRFLVDDIQVNGDISPIDVKQGKLAIDFRGYDADLAANIVTPDGELNVSGEANWQQLD
FT                   NWHSKVRFFADSLKVDMPPMVKIKLVPDMTIEVNPTLAKVTGSLALPWGRIVVEELPPS
FT                   AVSVSKDQVLLNDQLEPIDKSSSMPFNVETDINISIGDDFKLAAFGLEGGLKGQLNVTQ
FT                   KDKGPFILGEVNIVDGTYRSFGQDLLIKEGKVLMNGPADQPYVAIKAIRNPENTQDDVI
FT                   AGVKVTGPATEPSITIFSEPAMPQANALSYLLRGQDIDGESGGGNAMTTALIGLSLAKS
FT                   GKVVGEIGQAFGVQDLQLDTAGSGEDSQVTVSGYIMPGLQVKYGVGIFKPLGEFTVRYR
FT                   LMKDLYLEGVSGVESAVDLLYQFEFD"
     MIKVVFKWSK WISAGVMALL VLLLTLIALL LFTHPGLTSA IWVAEKVVPQ LQVGQVQGAL        60
     FPKFTLRKVT FNDAELNIAS SVDELTLAMN FQCLLEPKVC INEISIDGLA LSLPQLPPSS       120
     ESVEEPSEPL KSISTPVPVF LHRLALTNIQ LDVLGNQISW GELSSALSMQ GDRLVIAPTR       180
     FSDIDVTLAP SEPQAQSAAP NDAPRQDIEL PEVWIPLQIV LQRFDVNRFT LHQETPLIVN       240
     HLALEAKAGK NRVDVETLEL DMPQVSAQAN AQVELKGEYP LSLDLKAKLK ETDLKGQNIT       300
     LNASQSVAHL QLQSTLSGPV SAQLSATLEP LLVSLPFDVK LSDLQTQWPL SGESDYQIKS       360
     TNLMTQGSLE GYQLALQSQL DGKEIPAITL DVHGSGDLQH IDLDKLNVET LGGELKGQVM       420
     ANWQSLVNWQ ASLQLQNIQP GLQWPEAEGN ISGKLATTGS LTEKGGWKVA LPELDIDGLL       480
     RGYPLNIEGS LHASDEEGNG EVYIDTERLT LSHGPNGLTA KGQLKKEWQM DVDIHFTDLA       540
     KSVPDLSGSV VGDVDLRGAL KEPDIQLALQ AQNIQWQQQA SIEQLSLTGR VTPLPEPQAD       600
     VTLKVAALRY QEQLIDSILL SVSGGEKQHQ LSLDVSSDLV STSLAIHGGL QQKPQMVWSG       660
     ELERMFATTQ QGTWTLQQAT AIKANIDQQQ VDVAAHCWQQ QGSTLCLTKD IRVGEKGEAE       720
     LALNQFDFAQ IAMFLPPETK LDGSVDATVW AKWAPESSPQ AKVSLHLPTG QVQQKIEQVV       780
     TLGWDDINLN AQLHQDQLNA DWQINVSDNG DLTGQLQVAD VQASDPQLKA KLALSQFNLD       840
     FLAPLVGEYS ALKALISTDL SVSGSVYHPQ VKGRFLVDDI QVNGDISPID VKQGKLAIDF       900
     RGYDADLAAN IVTPDGELNV SGEANWQQLD NWHSKVRFFA DSLKVDMPPM VKIKLVPDMT       960
     IEVNPTLAKV TGSLALPWGR IVVEELPPSA VSVSKDQVLL NDQLEPIDKS SSMPFNVETD      1020
     INISIGDDFK LAAFGLEGGL KGQLNVTQKD KGPFILGEVN IVDGTYRSFG QDLLIKEGKV      1080
     LMNGPADQPY VAIKAIRNPE NTQDDVIAGV KVTGPATEPS ITIFSEPAMP QANALSYLLR      1140
     GQDIDGESGG GNAMTTALIG LSLAKSGKVV GEIGQAFGVQ DLQLDTAGSG EDSQVTVSGY      1200
     IMPGLQVKYG VGIFKPLGEF TVRYRLMKDL YLEGVSGVES AVDLLYQFEF D               1251
//

If you have problems or comments...

PBIL Back to PBIL home page