(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0431

BA000037.VV0431      Location/Qualifiers
FT   CDS             423264..423623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0431"
FT                   /product="hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93195"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93195"
FT                   /db_xref="InterPro:IPR021242"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPD3"
FT                   /protein_id="BAC93195.1"
FT                   /translation="MKALVLTFPLLLLVGCVQTPLPQSEQALDWHTFGVESALEGKMAL
FT                   SEARLLKLAEPRNLSANLLASYQAGYQEGKQQYCQQNAYMLGVIGKPYYGICDDVDPFF
FT                   KQDYISGQMSTAGGL"
     MKALVLTFPL LLLVGCVQTP LPQSEQALDW HTFGVESALE GKMALSEARL LKLAEPRNLS        60
     ANLLASYQAG YQEGKQQYCQ QNAYMLGVIG KPYYGICDDV DPFFKQDYIS GQMSTAGGL        119
//

If you have problems or comments...

PBIL Back to PBIL home page