(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0438

BA000037.VV0438      Location/Qualifiers
FT   CDS             429038..430609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0438"
FT                   /product="thiamine ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93202"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93202"
FT                   /db_xref="GOA:Q7MPC6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005947"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPC6"
FT                   /protein_id="BAC93202.1"
FT                   /translation="MIIATFVVSALSALLLATPTLDLTAVWQDPYYRHVTQFSFLQATL
FT                   SMLLSVGLALPVAHALSRRHFVGRSLLLKLFASTLVLPVLVGVFGLLAIYGNSGWLASV
FT                   LASFDVKLPFSIYGLSGILLAHVFFNLPYAARLLLQTLESIPAEQHKLAAHLGMNSWQK
FT                   FRWVEWPRLRQQLPHVCGLVFMLCFTSFATVMALGGGPKSTTIELAIYQAIKFDFDLQA
FT                   GALLAIWQMLLCSLLVLALQRLTKPLPVSVGSHTRFVQLTPASKRHLMWDYAWIALATL
FT                   LVVPPLLFVVASGINSKLPDVISDGRFWSALGASLRVAFGAATLAVGAAIAILLTSRAW
FT                   RLRGLRYPADGIEMVGTIILVTPGLVVSTGLFLLLRSFADVFSLSLLIVIIVNSLMALP
FT                   YAIKTLAQPMLHCEQQYQYLAATLGLSGWNRFKIVEWRALRKPFANAFALCFMFSIGDL
FT                   SAIALFGSQDFRTLPLYLYQLLGSYQMEAAAVVSLTLLLLSVGCFALSESLLSSKSNQH
FT                   QEKAPC"
     MIIATFVVSA LSALLLATPT LDLTAVWQDP YYRHVTQFSF LQATLSMLLS VGLALPVAHA        60
     LSRRHFVGRS LLLKLFASTL VLPVLVGVFG LLAIYGNSGW LASVLASFDV KLPFSIYGLS       120
     GILLAHVFFN LPYAARLLLQ TLESIPAEQH KLAAHLGMNS WQKFRWVEWP RLRQQLPHVC       180
     GLVFMLCFTS FATVMALGGG PKSTTIELAI YQAIKFDFDL QAGALLAIWQ MLLCSLLVLA       240
     LQRLTKPLPV SVGSHTRFVQ LTPASKRHLM WDYAWIALAT LLVVPPLLFV VASGINSKLP       300
     DVISDGRFWS ALGASLRVAF GAATLAVGAA IAILLTSRAW RLRGLRYPAD GIEMVGTIIL       360
     VTPGLVVSTG LFLLLRSFAD VFSLSLLIVI IVNSLMALPY AIKTLAQPML HCEQQYQYLA       420
     ATLGLSGWNR FKIVEWRALR KPFANAFALC FMFSIGDLSA IALFGSQDFR TLPLYLYQLL       480
     GSYQMEAAAV VSLTLLLLSV GCFALSESLL SSKSNQHQEK APC                         523
//

If you have problems or comments...

PBIL Back to PBIL home page