(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0445

BA000037.VV0445      Location/Qualifiers
FT   CDS             complement(435370..436233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0445"
FT                   /product="predicted P-loop-containing kinase"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93209"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93209"
FT                   /db_xref="GOA:Q7MPB9"
FT                   /db_xref="InterPro:IPR005337"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MPB9"
FT                   /protein_id="BAC93209.1"
FT                   /translation="MRLIVVSGHSGAGKSVALRVLEDMGYYCVDNLPVNLLESFIQSVS
FT                   ESKQNVAVSIDVRNIPKKLKELTTTLQKLKSSIDLSILFLDADKATLLKRYSETRRVHP
FT                   LSLSDECHTLDQAIDLEKKMLKPLKEIADILLNSSNQSLHDLSEDVRYRIEGKERNKLI
FT                   MVFESFGFKFGLPTDADYVFDVRFLPNPHWEPALRPMTGLDAPIKTFLESHDEVLELKR
FT                   QIQTFIEHWLPLLEKNNRSYLTVAIGCTGGKHRSVYLTQQIGEYFAAMGHTVKIRHTTL
FT                   EKRNKE"
     MRLIVVSGHS GAGKSVALRV LEDMGYYCVD NLPVNLLESF IQSVSESKQN VAVSIDVRNI        60
     PKKLKELTTT LQKLKSSIDL SILFLDADKA TLLKRYSETR RVHPLSLSDE CHTLDQAIDL       120
     EKKMLKPLKE IADILLNSSN QSLHDLSEDV RYRIEGKERN KLIMVFESFG FKFGLPTDAD       180
     YVFDVRFLPN PHWEPALRPM TGLDAPIKTF LESHDEVLEL KRQIQTFIEH WLPLLEKNNR       240
     SYLTVAIGCT GGKHRSVYLT QQIGEYFAAM GHTVKIRHTT LEKRNKE                     287
//

If you have problems or comments...

PBIL Back to PBIL home page