(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0446

BA000037.VV0446      Location/Qualifiers
FT   CDS             complement(436246..436692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0446"
FT                   /product="nitrogen regulatory IIA protein PtsN"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93210"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93210"
FT                   /db_xref="GOA:Q7MPB8"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR006320"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPB8"
FT                   /protein_id="BAC93210.1"
FT                   /translation="MQLSTILSLDCTKSAVQCSSKKRALEIISNLVAEHTGQDSTELFE
FT                   CMLSREKMGSTGIGNGIAIPHARMTAADKAVAVLLQCEEPIDFDSIDNRPVDLLFALLV
FT                   PEEQCKEHLKTLSSMAERLSDKQVLKLLRSAQSDQELYDIMTNQ"
     MQLSTILSLD CTKSAVQCSS KKRALEIISN LVAEHTGQDS TELFECMLSR EKMGSTGIGN        60
     GIAIPHARMT AADKAVAVLL QCEEPIDFDS IDNRPVDLLF ALLVPEEQCK EHLKTLSSMA       120
     ERLSDKQVLK LLRSAQSDQE LYDIMTNQ                                          148
//

If you have problems or comments...

PBIL Back to PBIL home page