(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0448

BA000037.VV0448      Location/Qualifiers
FT   CDS             complement(437006..438469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0448"
FT                   /product="DNA-directed RNA polymerase specialized sigma
FT                   subunit"
FT                   /note="sigma54 homolog"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93212"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93212"
FT                   /db_xref="GOA:Q7MPB6"
FT                   /db_xref="InterPro:IPR000394"
FT                   /db_xref="InterPro:IPR007046"
FT                   /db_xref="InterPro:IPR007634"
FT                   /db_xref="InterPro:IPR038709"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPB6"
FT                   /protein_id="BAC93212.1"
FT                   /translation="MKPSLQLKLGQQLAMTPQLQQAIRLLQLSTLDLQQEIQEALESNP
FT                   LLEVEEHQEEAQLNGEDKAINEGSDSDDFSVEIDIPDSSDVIEKSEISSELEIDTTWDD
FT                   VYSANSGNTGIALDDDMPVYQGETTETLHDYLQWQLDLTPFSDTDRMIAFAIIDAVDDT
FT                   GYLTISPEEILESLNSVDIELDEVEAVRKRIQQFDPLGVASQNLQECLLLQLATFPTET
FT                   PWLAEAKMVLSHHIDALGNRDYKLIVKEAKLKEEDLRETLKLIQQLDPRPGSKINAIEP
FT                   EYVIPDVSVFKEHGKWSVAINPDSIPKLKVNQQYAQLGKGSSADSQYIRSNLQEAKWLI
FT                   KSLESRNETLLKVARCIVEHQHDFFEYGEEAMKPMVLNDVATAVEMHESTISRVTTQKF
FT                   MHTPRGIFELKYFFSSHVSTDSGGECSSTAIRALIKKLVTAENSAKPLSDSKIAALLAD
FT                   QGIQVARRTIAKYRESLGIAPSSQRKRLL"
     MKPSLQLKLG QQLAMTPQLQ QAIRLLQLST LDLQQEIQEA LESNPLLEVE EHQEEAQLNG        60
     EDKAINEGSD SDDFSVEIDI PDSSDVIEKS EISSELEIDT TWDDVYSANS GNTGIALDDD       120
     MPVYQGETTE TLHDYLQWQL DLTPFSDTDR MIAFAIIDAV DDTGYLTISP EEILESLNSV       180
     DIELDEVEAV RKRIQQFDPL GVASQNLQEC LLLQLATFPT ETPWLAEAKM VLSHHIDALG       240
     NRDYKLIVKE AKLKEEDLRE TLKLIQQLDP RPGSKINAIE PEYVIPDVSV FKEHGKWSVA       300
     INPDSIPKLK VNQQYAQLGK GSSADSQYIR SNLQEAKWLI KSLESRNETL LKVARCIVEH       360
     QHDFFEYGEE AMKPMVLNDV ATAVEMHEST ISRVTTQKFM HTPRGIFELK YFFSSHVSTD       420
     SGGECSSTAI RALIKKLVTA ENSAKPLSDS KIAALLADQG IQVARRTIAK YRESLGIAPS       480
     SQRKRLL                                                                 487
//

If you have problems or comments...

PBIL Back to PBIL home page