(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0450

BA000037.VV0450      Location/Qualifiers
FT   CDS             complement(439248..439757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0450"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93214"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93214"
FT                   /db_xref="GOA:Q7MPB4"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="InterPro:IPR014340"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPB4"
FT                   /protein_id="BAC93214.1"
FT                   /translation="MYKVDMKPLHLSLFALMLATSNAYALKSDTQQPVYIDSDSQQLDM
FT                   RSNQVIFDGDVSLKQGSININADKIVVTRDPESNTIKKIEAFGQPATFSQLMDDGKTLS
FT                   GSAKQLDYSIDNDQLTMKGQAELAQDNNVIKGSSIVYQIALQKLMADSSKNERVTTVLQ
FT                   PSQVNN"
     MYKVDMKPLH LSLFALMLAT SNAYALKSDT QQPVYIDSDS QQLDMRSNQV IFDGDVSLKQ        60
     GSININADKI VVTRDPESNT IKKIEAFGQP ATFSQLMDDG KTLSGSAKQL DYSIDNDQLT       120
     MKGQAELAQD NNVIKGSSIV YQIALQKLMA DSSKNERVTT VLQPSQVNN                   169
//

If you have problems or comments...

PBIL Back to PBIL home page