(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0454

BA000037.VV0454      Location/Qualifiers
FT   CDS             complement(441833..442876)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0454"
FT                   /product="putative sodium/calcium exchanger protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93218"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93218"
FT                   /db_xref="GOA:Q7MPB0"
FT                   /db_xref="InterPro:IPR004481"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPB0"
FT                   /protein_id="BAC93218.1"
FT                   /translation="MASIFVGKRSKLAVNHSTYHYFLELIMLEAVALLIVGLILLVWSA
FT                   DKLVFGSAALARNIGISPLVIGMTILAMGSSAPEMMVSATAALDGKTDTAVGNVLGSNI
FT                   ANIALILGITALVRPLSINSAVVRRELPLMIGVTVLAGILLWDSHLGFYEGVLLFVLFT
FT                   LFLVAMLQISRREQKTGDAFLEEQESEIPQGVSNPKAAMWIVIGLILLPLAADMLVDNA
FT                   VIIAKYFGMSDLVIGLTIIAVGTSLPELAASLAGALKGEDDMAVGNIIGSNVFNILAVM
FT                   GIPGILNPSFISEYAMGRDFWVMLAISLLLVVMALGKSRRISRTEGGILLTCFIGYQAY
FT                   LLMNMAA"
     MASIFVGKRS KLAVNHSTYH YFLELIMLEA VALLIVGLIL LVWSADKLVF GSAALARNIG        60
     ISPLVIGMTI LAMGSSAPEM MVSATAALDG KTDTAVGNVL GSNIANIALI LGITALVRPL       120
     SINSAVVRRE LPLMIGVTVL AGILLWDSHL GFYEGVLLFV LFTLFLVAML QISRREQKTG       180
     DAFLEEQESE IPQGVSNPKA AMWIVIGLIL LPLAADMLVD NAVIIAKYFG MSDLVIGLTI       240
     IAVGTSLPEL AASLAGALKG EDDMAVGNII GSNVFNILAV MGIPGILNPS FISEYAMGRD       300
     FWVMLAISLL LVVMALGKSR RISRTEGGIL LTCFIGYQAY LLMNMAA                     347
//

If you have problems or comments...

PBIL Back to PBIL home page