(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0473

BA000037.VV0473      Location/Qualifiers
FT   CDS             458499..459266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0473"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93237"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93237"
FT                   /db_xref="GOA:Q7MP91"
FT                   /db_xref="InterPro:IPR010619"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MP91"
FT                   /protein_id="BAC93237.1"
FT                   /translation="MASTQRAISRLVAQAGQMLLAHGAESTLVGDIMHRIGIASGVSEV
FT                   EVALSANALVVTTVMDGHCITTTRSCVDRGINMKAVTEIQRICIMMEKGVLDPMMAQRK
FT                   LNNISPERYNRWLVVFMIGISCASFARLAGGDWAVFAMTFLASACGMIVRQEIGHRHFN
FT                   PLLNFAATAFVTTLISAQAVILEIGNLPTVVMASSVLMLVPGFPLINSVADMLKGHINM
FT                   GIARFVMASLLTLATSLGIVAAMSVTGIWGWSS"
     MASTQRAISR LVAQAGQMLL AHGAESTLVG DIMHRIGIAS GVSEVEVALS ANALVVTTVM        60
     DGHCITTTRS CVDRGINMKA VTEIQRICIM MEKGVLDPMM AQRKLNNISP ERYNRWLVVF       120
     MIGISCASFA RLAGGDWAVF AMTFLASACG MIVRQEIGHR HFNPLLNFAA TAFVTTLISA       180
     QAVILEIGNL PTVVMASSVL MLVPGFPLIN SVADMLKGHI NMGIARFVMA SLLTLATSLG       240
     IVAAMSVTGI WGWSS                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page