(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0481

BA000037.VV0481      Location/Qualifiers
FT   CDS             complement(464752..467082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0481"
FT                   /product="organic solvent tolerance protein OstA"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93245"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93245"
FT                   /db_xref="GOA:Q7MP83"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="InterPro:IPR007543"
FT                   /db_xref="InterPro:IPR020889"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MP83"
FT                   /protein_id="BAC93245.1"
FT                   /translation="MQHFSRTFLAASIATALFAPYAQAEAILNNSVQEMPTTDQCLVDA
FT                   EKNDANAEIVIQADNLQAINGDKAIYSGDVEVTQGNKKITAESVTLHQQENIVVAEGNV
FT                   TFNDGEVKASSSKVTNNMTSETFSLENTEYQFLCQQGRGQAAYIAKTGQAVYELEDGSI
FT                   TSCPADDNAWRLVASSIEVDQDEETATFYHPRFEVLDVPVFYAPYLTLPIGNTRKTGFL
FT                   FPSVNYGSSDGLEIEVPFYWNIAPNYDLTLTTLYMQQRGVKQDADFRYLSDGWGSGELK
FT                   GEYLPGDEKYNDEDRWGYQYKHDGIINKQWLVSLDYSQVSDIDYFRDLSSDLGNREDGQ
FT                   LMQQGKVAYRSDFWDMSLQVRDFQILLQDNNQPYRLLPQVKFNFYTPLLGNYLNFDVKS
FT                   ELTQFDIQDASKPNALRAHVEPGLTIPLSTSWATWTTEARLLATYYQQDLDRLTDPTLK
FT                   SQLDETVARVIPEYRSHARIYLEREAKLFEGYTQSLEPQIQYLYVPEEEQGNIYNYDTT
FT                   LLQTDYYGLFRSRKYSSIDKIAAANQLSYGASTRFFDDEYKERLNISFGQIYYIDKKTK
FT                   LTGNQEETSNYSSWAVETDFNYEDFLFYHGGIQYDIDLNAMQLANSTLEYQFTDGFIQG
FT                   NYRYVTKDYIEDTISFDELDKITRKGISQAGIVGAYNINRHWSASGQYYYDLTEEIDLE
FT                   WMASLRYQSDCWYIGFTYTNQLVKWRNDVVGGDSNNPVYDTNISVNFGIQGFATKNKAE
FT                   TAAKELDSTDNAITYGRPFYLNN"
     MQHFSRTFLA ASIATALFAP YAQAEAILNN SVQEMPTTDQ CLVDAEKNDA NAEIVIQADN        60
     LQAINGDKAI YSGDVEVTQG NKKITAESVT LHQQENIVVA EGNVTFNDGE VKASSSKVTN       120
     NMTSETFSLE NTEYQFLCQQ GRGQAAYIAK TGQAVYELED GSITSCPADD NAWRLVASSI       180
     EVDQDEETAT FYHPRFEVLD VPVFYAPYLT LPIGNTRKTG FLFPSVNYGS SDGLEIEVPF       240
     YWNIAPNYDL TLTTLYMQQR GVKQDADFRY LSDGWGSGEL KGEYLPGDEK YNDEDRWGYQ       300
     YKHDGIINKQ WLVSLDYSQV SDIDYFRDLS SDLGNREDGQ LMQQGKVAYR SDFWDMSLQV       360
     RDFQILLQDN NQPYRLLPQV KFNFYTPLLG NYLNFDVKSE LTQFDIQDAS KPNALRAHVE       420
     PGLTIPLSTS WATWTTEARL LATYYQQDLD RLTDPTLKSQ LDETVARVIP EYRSHARIYL       480
     EREAKLFEGY TQSLEPQIQY LYVPEEEQGN IYNYDTTLLQ TDYYGLFRSR KYSSIDKIAA       540
     ANQLSYGAST RFFDDEYKER LNISFGQIYY IDKKTKLTGN QEETSNYSSW AVETDFNYED       600
     FLFYHGGIQY DIDLNAMQLA NSTLEYQFTD GFIQGNYRYV TKDYIEDTIS FDELDKITRK       660
     GISQAGIVGA YNINRHWSAS GQYYYDLTEE IDLEWMASLR YQSDCWYIGF TYTNQLVKWR       720
     NDVVGGDSNN PVYDTNISVN FGIQGFATKN KAETAAKELD STDNAITYGR PFYLNN           776
//

If you have problems or comments...

PBIL Back to PBIL home page