(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0511

BA000037.VV0511      Location/Qualifiers
FT   CDS             501249..501929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0511"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93275"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93275"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MP53"
FT                   /protein_id="BAC93275.1"
FT                   /translation="MNVRSRKNKNLRLTTKKTFLGRPIQTEHGPLYLDYLEKMHNTIDI
FT                   ALDEYPRLMAIRVDLRFPKLRKNEMSGNVMTDFLRSLQSQIDHSGKRKKREGSVRVHPC
FT                   KVRIAWVRERSSSINDHYHLVLMFNKDRFNWLGKTQTQQENLGSFIVEAWARVAGVDYE
FT                   EANGLVHFSKRKNSDSVVIHRLNCNSDAFDDAFDEFFKHISYLAKENTKHFGSGRRNFG
FT                   HSHK"
     MNVRSRKNKN LRLTTKKTFL GRPIQTEHGP LYLDYLEKMH NTIDIALDEY PRLMAIRVDL        60
     RFPKLRKNEM SGNVMTDFLR SLQSQIDHSG KRKKREGSVR VHPCKVRIAW VRERSSSIND       120
     HYHLVLMFNK DRFNWLGKTQ TQQENLGSFI VEAWARVAGV DYEEANGLVH FSKRKNSDSV       180
     VIHRLNCNSD AFDDAFDEFF KHISYLAKEN TKHFGSGRRN FGHSHK                      226
//

If you have problems or comments...

PBIL Back to PBIL home page