(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0517

BA000037.VV0517      Location/Qualifiers
FT   CDS             504132..505373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0517"
FT                   /product="hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93281"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93281"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MP47"
FT                   /protein_id="BAC93281.1"
FT                   /translation="MGCTPQAVILIYHYYCWLREFLLTFQYCPRNELSLMLNEKFRMPV
FT                   IKLGNPFLPSPDEVSAFLGLPVSPREKIKWLNASVVKSKLPTDRTLDNISKEGIRWKSI
FT                   RQFAWQLARVFVRKGWSLNVSLPDGGIHKSDLSFWWSHTLKGVQQGLSSTSGELNLGLL
FT                   VSYIDKRCVAYQRQLAFIQDAPDINENNQHELISGYYLPVLDFTLLSEQEKALVKNWLK
FT                   SPSELASKETEQAMLCFCYDFWLSLMSVIDVMFLEDWDKHYAEYTPSVHAQQYGLFGQV
FT                   FNREERTFLGKFFGLIKEQTNQTYAQLSEYVVLPVSEYERNGLLKRDVQQARFKEWRSG
FT                   KSLPSVEALSTFFANMDAGRQGADLLIYALFMRALDKVGSRSLPDIYTKVGSRSLPDIY
FT                   TTSRYQRYFQHYAP"
     MGCTPQAVIL IYHYYCWLRE FLLTFQYCPR NELSLMLNEK FRMPVIKLGN PFLPSPDEVS        60
     AFLGLPVSPR EKIKWLNASV VKSKLPTDRT LDNISKEGIR WKSIRQFAWQ LARVFVRKGW       120
     SLNVSLPDGG IHKSDLSFWW SHTLKGVQQG LSSTSGELNL GLLVSYIDKR CVAYQRQLAF       180
     IQDAPDINEN NQHELISGYY LPVLDFTLLS EQEKALVKNW LKSPSELASK ETEQAMLCFC       240
     YDFWLSLMSV IDVMFLEDWD KHYAEYTPSV HAQQYGLFGQ VFNREERTFL GKFFGLIKEQ       300
     TNQTYAQLSE YVVLPVSEYE RNGLLKRDVQ QARFKEWRSG KSLPSVEALS TFFANMDAGR       360
     QGADLLIYAL FMRALDKVGS RSLPDIYTKV GSRSLPDIYT TSRYQRYFQH YAP              413
//

If you have problems or comments...

PBIL Back to PBIL home page