(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0530

BA000037.VV0530      Location/Qualifiers
FT   CDS             513467..514510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0530"
FT                   /product="putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93294"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93294"
FT                   /db_xref="GOA:Q7MP34"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR027839"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MP34"
FT                   /protein_id="BAC93294.1"
FT                   /translation="MAFLFRRRFMYIIPLNKAQFNQQETILIQSEDFKVSAFKYNSGVE
FT                   GLKIENAKGYLTILPYMGQMIWDAKFLGEDICMENMFSEPKPSNEIVATYGCFAFHSGM
FT                   IRNGCPSPEDDHPLHGEMPCANMDKVWLEVDEYQITLKGEYEYVMGFGDHYLATPSVSI
FT                   EKGASMFEIKMKVQNLASVPMPLQYMCHMNTAYFPEAKMTQNIPDSAVKLRKSIPGHVK
FT                   PTQQWLDFNDTLKAQSAPIHQLSAPDMYDPEIVYFMDNLSQHTDNAEFEMTIPNGKTLI
FT                   TRFDTTEFNYATRWILYNGDQKVGAYVLPATCRPEGYLAAEKNGTLIQLQPKEVREFTV
FT                   KTGIIEK"
     MAFLFRRRFM YIIPLNKAQF NQQETILIQS EDFKVSAFKY NSGVEGLKIE NAKGYLTILP        60
     YMGQMIWDAK FLGEDICMEN MFSEPKPSNE IVATYGCFAF HSGMIRNGCP SPEDDHPLHG       120
     EMPCANMDKV WLEVDEYQIT LKGEYEYVMG FGDHYLATPS VSIEKGASMF EIKMKVQNLA       180
     SVPMPLQYMC HMNTAYFPEA KMTQNIPDSA VKLRKSIPGH VKPTQQWLDF NDTLKAQSAP       240
     IHQLSAPDMY DPEIVYFMDN LSQHTDNAEF EMTIPNGKTL ITRFDTTEFN YATRWILYNG       300
     DQKVGAYVLP ATCRPEGYLA AEKNGTLIQL QPKEVREFTV KTGIIEK                     347
//

If you have problems or comments...

PBIL Back to PBIL home page